DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and Psmd9

DIOPT Version :10

Sequence 1:NP_650366.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_080276.2 Gene:Psmd9 / 67151 MGIID:1914401 Length:222 Species:Mus musculus


Alignment Length:84 Identity:20/84 - (23%)
Similarity:35/84 - (41%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD--ALADNS--K 400
            |.|.|..:|.....   |..:..||||...|||..|.:........:|...|.:  .:..:|  |
Mouse   124 LASNSPVLPQAFAR---VNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSVQNVGTVVQHSEGK 185

  Fly   401 TLDIVILRGVKQMHVTITP 419
            .|::.::|..::..:.:.|
Mouse   186 PLNVTVIRRGEKHQLRLIP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_650366.1 DegQ 141..421 CDD:440035 20/84 (24%)
Psmd9NP_080276.2 Nas2_N 23..102 CDD:465689
RseP <129..>214 CDD:440513 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.