DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and PSMD9

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_002804.2 Gene:PSMD9 / 5715 HGNCID:9567 Length:223 Species:Homo sapiens


Alignment Length:213 Identity:44/213 - (20%)
Similarity:79/213 - (37%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 AGVISSTQRASQELGLRNRDI------NY--LQTDAAITFGNSGGPLVNLDG---EAIGVNSMKV 285
            |||:  |....|||..|..:|      ||  |::...|....   |||:.:|   ..:.:..::.
Human    15 AGVV--TVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNE---PLVDCEGYPRSDVDLYQVRT 74

  Fly   286 TAGISFAIPIDYVKVFLE----------RAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFEL 340
            .......:..|:..|..:          |..||:.:..|......:.|.:|              
Human    75 ARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLG-------------- 125

  Fly   341 KSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD--ALADNS--KT 401
            :|.||..|.....   |..:..||||...|||..|.:........:|...:::  ::..:|  |.
Human   126 QSESQGPPRAFAK---VNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKP 187

  Fly   402 LDIVILRGVKQMHVTITP 419
            |::.::|..::..:.:.|
Human   188 LNVTVIRRGEKHQLRLVP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 44/213 (21%)
Trypsin_2 141..280 CDD:290102 17/58 (29%)
PDZ_serine_protease 323..417 CDD:238487 20/97 (21%)
PSMD9NP_002804.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..141 11/54 (20%)
PDZ_metalloprotease 129..205 CDD:238489 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.