DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and LOC560917

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021335194.1 Gene:LOC560917 / 560917 -ID:- Length:321 Species:Danio rerio


Alignment Length:322 Identity:155/322 - (48%)
Similarity:228/322 - (70%) Gaps:22/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTF 177
            |...|..|.:...||  .|||:.:..||||||||..:|||:||||||.||  ..|:|:|::|.|:
Zfish     5 CLGIVTNITLFLFRH--PFSGREVPISNGSGFIISSDGLIVTNAHVVANK--RGVRVKLTNGETY 65

  Fly   178 PATIEDVDQTSDLATLRIQVNN-LSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRA 241
            .||::||||.:|:||::|.|.| |..:||||||.:|.||:|||:|||.:|.||:|:|::||.||.
Zfish    66 NATVQDVDQAADIATIKINVKNPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRD 130

  Fly   242 SQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAA 306
            |:||||.|.:::|:||||.|.||||||||:::|||.||:|:||||||||||||.|.|::||:|:.
Zfish   131 SKELGLSNSNMDYIQTDATIDFGNSGGPLIHMDGEVIGINTMKVTAGISFAIPSDRVRLFLDRSV 195

  Fly   307 EKRKKGSAYKTGYPVKRYMGITMLTLTPDILF-------------ELKSRSQNMPSNLTHGVLVW 358
            ::.:  |.:......:||:|:.||||||.:|.             ||:.|..:.| :::||||:.
Zfish   196 DRVR--SWFGESGSKRRYIGVMMLTLTPSLLLSLNSLFPLLTIIEELRMRDPSFP-DVSHGVLIH 257

  Fly   359 KVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE 420
            :|||||||:..|::|||::..||..::..|.::|:|:. .|::|::|:.||...:.:.:|||
Zfish   258 RVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLMLHMTPE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 155/322 (48%)
Trypsin_2 141..280 CDD:290102 83/139 (60%)
PDZ_serine_protease 323..417 CDD:238487 39/106 (37%)
LOC560917XP_021335194.1 DegQ 20..>298 CDD:333159 142/283 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3556
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 1 1.050 326 1.000 Inparanoid score I2456
OMA 1 1.010 - - QHG59008
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm25664
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.