DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and psmd9

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001002436.2 Gene:psmd9 / 436709 ZFINID:ZDB-GENE-030131-431 Length:211 Species:Danio rerio


Alignment Length:212 Identity:48/212 - (22%)
Similarity:85/212 - (40%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LALSNTVTAGVISSTQRASQELGLRNRDI--------NYLQTDAAITFGNSGGPLVNLDG-EAIG 279
            :.:|....|.|...|:...::|..|..||        :.|::.|.:   ...||||:::| ....
Zfish     1 MKMSEENRAVVSRMTEEDVRQLIKRKDDIEEQIKAYYDMLESQAGV---GMDGPLVDVEGFPRAD 62

  Fly   280 VNSMKV-TAGISFA-IPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKS 342
            |:..|| ||..|.: :..|:..:.:|......|..:..|..:.            ..|...|...
Zfish    63 VDLYKVRTARHSISCLQNDHKAIMVEIEEALHKLHATAKVTHE------------QDDTQMESSG 115

  Fly   343 RSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTH---INKKEIKNSSDVYDALA-DNSKTLD 403
            ::...|...   .||..|..||||...||..||.:..   :|.:..:|..|:...:. ...|:|.
Zfish   116 QTVETPPPF---ALVDAVTHGSPAAQAGLHVGDQIMEFGSVNTQNFRNLRDIASVVQHSEGKSLR 177

  Fly   404 IVILRGVKQMHVTITPE 420
            :.:.|..:::|:.:||:
Zfish   178 VGVFRNGQEVHLNLTPQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 48/212 (23%)
Trypsin_2 141..280 CDD:290102 15/64 (23%)
PDZ_serine_protease 323..417 CDD:238487 21/97 (22%)
psmd9NP_001002436.2 DegQ <50..198 CDD:223343 38/160 (24%)
PDZ_metalloprotease 117..193 CDD:238489 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.