powered by:
Protein Alignment HtrA2 and CG9588
DIOPT Version :9
Sequence 1: | NP_001262565.1 |
Gene: | HtrA2 / 41756 |
FlyBaseID: | FBgn0038233 |
Length: | 422 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650301.1 |
Gene: | CG9588 / 41672 |
FlyBaseID: | FBgn0038166 |
Length: | 220 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 31/71 - (43%) |
Gaps: | 5/71 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 355 VLVWKVIVGSPAHSGGLQPGDIVTH---INKKEIKNSSDVYDALADN--SKTLDIVILRGVKQMH 414
|:|..|...|||...||..||.:.. ||....|........|..| |:.:.:.:.||.:|:.
Fly 129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193
Fly 415 VTITPE 420
:.:.|:
Fly 194 LILVPK 199
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0265 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.