DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and CG9588

DIOPT Version :10

Sequence 1:NP_650366.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:31/71 - (43%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 VLVWKVIVGSPAHSGGLQPGDIVTH---INKKEIKNSSDVYDALADN--SKTLDIVILRGVKQMH 414
            |:|..|...|||...||..||.:..   ||....|........|..|  |:.:.:.:.||.:|:.
  Fly   129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193

  Fly   415 VTITPE 420
            :.:.|:
  Fly   194 LILVPK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_650366.1 DegQ 141..421 CDD:440035 20/71 (28%)
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689
RseP <130..>208 CDD:440513 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.