DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and SPBC1685.05

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_595209.1 Gene:SPBC1685.05 / 2539936 PomBaseID:SPBC1685.05 Length:997 Species:Schizosaccharomyces pombe


Alignment Length:366 Identity:85/366 - (23%)
Similarity:154/366 - (42%) Gaps:88/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGS----GFIIEQN-GLILTNAHVVINKP 163
            |.|.:||.    |:|.|:....|.||       |.|.||    ||::.:. ||||:|.|||...|
pombe    69 NTIKNVVR----SIVSIKGSALRSFD-------TESAGSFCATGFVVNKTLGLILSNRHVVSPGP 122

  Fly   164 HTMVQVRLSDGRTFPATIEDV-------DQTSDLATLR-----IQVNNLSVMRLGKSSTLRSGEW 216
                   :|...:| ...|::       |...|....|     |:.::::.:.|...|. :.|..
pombe   123 -------ISARASF-INYEEIDIYPIYRDPVHDFGFFRYDPSSIRFHDVTEISLSPESA-KVGID 178

  Fly   217 VVALGSPLALSNTVTAGVISSTQRASQELGLRN-RDIN--YLQTDAAITFGNSGGPLVNLDGEAI 278
            :..:|:......::.:..::...|.:...|:.| .|.|  |.|..:..:.|:||.|::::.|.|:
pombe   179 IRIIGNDAGEKLSILSSTLARLDRPAPNYGIDNYNDFNTFYYQAASGTSGGSSGSPVLDISGAAV 243

  Fly   279 GVNS-MKVTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKR-----------YMGITMLT 331
            .:|| ...::..||.:|:|.| |...|..|...         |:.|           |..::.:.
pombe   244 ALNSGGSNSSASSFYLPLDRV-VRALRCIENNT---------PITRGTLLTEFLHWSYDELSRIG 298

  Fly   332 LTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNS-------- 388
            |..:..::.::|   :||:.  |:||...::.:...|..|:||||:........|::        
pombe   299 LPREFEYDCRTR---VPSST--GLLVVSRVLRNSEVSKALEPGDILIAFKTDSHKSTYIVDFVSL 358

  Fly   389 SDVYDALADNSKTLDIVILR----------GVKQMHVTITP 419
            .:|.|.:.  .||:::.:.|          .|:.:| .:||
pombe   359 FEVLDEMV--GKTIELHVYRPKRGFLTFQLTVQDLH-NVTP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 85/366 (23%)
Trypsin_2 141..280 CDD:290102 37/158 (23%)
PDZ_serine_protease 323..417 CDD:238487 23/122 (19%)
SPBC1685.05NP_595209.1 DegQ 66..397 CDD:223343 85/366 (23%)
Trypsin_2 99..245 CDD:290102 35/154 (23%)
PDZ_1 394..469 CDD:289574 2/3 (67%)
PDZ <814..855 CDD:294084
PDZ <893..963 CDD:294084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.