DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and HTRA4

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_710159.1 Gene:HTRA4 / 203100 HGNCID:26909 Length:476 Species:Homo sapiens


Alignment Length:328 Identity:147/328 - (44%)
Similarity:217/328 - (66%) Gaps:25/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITAS------NGSGFIIEQNGLILTNAHV 158
            ||::||||.||...|.|||::::         .|:.:..|      :|||||:.::|||:|||||
Human   164 RRNYNFIAAVVEKVAPSVVHVQL---------WGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHV 219

  Fly   159 VINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVN-NLSVMRLGKSSTLRSGEWVVALGS 222
            |.|:  ..::|.|.:|..:.|.::|:|...|||.::|:.| .|.|:.||:||.||:||:||||||
Human   220 VRNQ--QWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGS 282

  Fly   223 PLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTA 287
            |.:|.||.|||::|:.||..:|||:::.|::|:|.||.|.:||||||||||||:.|||||::||.
Human   283 PFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTD 347

  Fly   288 GISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLT 352
            |||||||.|.|:.||....|.:.||.|:..    |:|:|:.||:||..:..|||....:.| :::
Human   348 GISFAIPSDRVRQFLAEYHEHQMKGKAFSN----KKYLGLQMLSLTVPLSEELKMHYPDFP-DVS 407

  Fly   353 HGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTI 417
            .||.|.||:.|:.|.|.||:..|::.:||.|.|..::||..||  :|.:|.:.:|||...:.:|:
Human   408 SGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKAL--DSDSLSMAVLRGKDNLLLTV 470

  Fly   418 TPE 420
            .||
Human   471 IPE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 147/328 (45%)
Trypsin_2 141..280 CDD:290102 74/139 (53%)
PDZ_serine_protease 323..417 CDD:238487 34/93 (37%)
HTRA4NP_710159.1 IGFBP 40..94 CDD:278641
Kazal_2 108..152 CDD:284958
DegQ 156..470 CDD:223343 144/323 (45%)
Serine protease 202..362 89/161 (55%)
Trypsin_2 202..340 CDD:290102 74/139 (53%)
PDZ_serine_protease 380..470 CDD:238487 34/92 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3884
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100391
Panther 1 1.100 - - O PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.