DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and LOC110438965

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021328337.1 Gene:LOC110438965 / 110438965 -ID:- Length:308 Species:Danio rerio


Alignment Length:314 Identity:157/314 - (50%)
Similarity:226/314 - (71%) Gaps:19/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTF 177
            |...|..|.:...||  .|||:.:..||||||||..:.||:||||||.||  ..|:|:|::|.|:
Zfish     5 CLGIVTNITLFLFRH--PFSGREVPISNGSGFIISSDDLIVTNAHVVANK--RGVRVKLTNGETY 65

  Fly   178 PATIEDVDQTSDLATLRIQVNN-LSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRA 241
            .||::||||.:|:||::|.|.. |..:||||||.:|.||:|||:|||.:|.||:|:|::||.||.
Zfish    66 SATVQDVDQAADIATIKINVKTPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRG 130

  Fly   242 SQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAA 306
            |:||||.|.:::|:||||.|.||||||||:|||||.||:|:||||||||||||.|.|::||:|:|
Zfish   131 SKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRLFLDRSA 195

  Fly   307 EKR-----KKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPA 366
            :|:     :.||.       :||:|:.||||||.|:.||:.|..:.| :::||||:.:|||||||
Zfish   196 DKQNSWFGESGSK-------RRYIGVMMLTLTPSIIEELRMRDPSFP-DVSHGVLIHRVIVGSPA 252

  Fly   367 HSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE 420
            :..|::|||:...|...::..|.::|:|:. .|::|::|:.||...:.:.:|||
Zfish   253 NRAGMKPGDVNIEIKGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLMLHMTPE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 157/314 (50%)
Trypsin_2 141..280 CDD:290102 83/139 (60%)
PDZ_serine_protease 323..417 CDD:238487 38/93 (41%)
LOC110438965XP_021328337.1 DegQ 20..>285 CDD:333159 144/275 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3556
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2456
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm25664
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.