Sequence 1: | NP_001262565.1 | Gene: | HtrA2 / 41756 | FlyBaseID: | FBgn0038233 | Length: | 422 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021328008.1 | Gene: | LOC110438863 / 110438863 | -ID: | - | Length: | 183 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 97/201 - (48%) |
---|---|---|---|
Similarity: | 143/201 - (71%) | Gaps: | 21/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
Fly 285 VTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPS 349
Fly 350 NLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMH 414
Fly 415 VTITPE 420 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HtrA2 | NP_001262565.1 | DegQ | 67..422 | CDD:223343 | 97/201 (48%) |
Trypsin_2 | 141..280 | CDD:290102 | 38/59 (64%) | ||
PDZ_serine_protease | 323..417 | CDD:238487 | 33/93 (35%) | ||
LOC110438863 | XP_021328008.1 | DegQ | <1..>151 | CDD:333159 | 87/169 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D238833at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |