DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and LOC110437759

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021334889.1 Gene:LOC110437759 / 110437759 -ID:- Length:309 Species:Danio rerio


Alignment Length:296 Identity:152/296 - (51%)
Similarity:222/296 - (75%) Gaps:17/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 FSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRI 195
            |||:.:..||||||||..:|||:||||.|.||  ..|:|:|::|.|:.||::||||.:|:||::|
Zfish     8 FSGREVPISNGSGFIISSDGLIVTNAHAVANK--RGVRVKLTNGETYNATVQDVDQAADIATIKI 70

  Fly   196 QVNN-LSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDA 259
            .|.| |..:||||||.:|.||:|||:|||.:|.||:|:|::||.||.|:||||.|.:::|:||||
Zfish    71 NVKNPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDA 135

  Fly   260 AITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKR-----KKGSAYKTGY 319
            .|.||||||||::||||.|.:|:||||||||||||.|.|::||:|:|:|:     :.||.     
Zfish   136 TIDFGNSGGPLIHLDGEVISINTMKVTAGISFAIPSDRVRLFLDRSADKQNSWFGESGSK----- 195

  Fly   320 PVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKE 384
              :||:|:.||||||.|:.||:.|..:.| :::||||:.:|||||||:..|::|||::..||..:
Zfish   196 --RRYIGVMMLTLTPSIIDELRMRDPSFP-DVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVK 257

  Fly   385 IKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE 420
            :..|.::|:|:. .|::|::|:.||...:.:.:|||
Zfish   258 VNTSEEIYNAVR-TSESLNVVVRRGADLLMLHMTPE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 152/296 (51%)
Trypsin_2 141..280 CDD:290102 83/139 (60%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)
LOC110437759XP_021334889.1 DegQ 7..>272 CDD:333159 144/274 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.