DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and htra2

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_031750958.1 Gene:htra2 / 100492982 XenbaseID:XB-GENE-6044196 Length:436 Species:Xenopus tropicalis


Alignment Length:324 Identity:169/324 - (52%)
Similarity:229/324 - (70%) Gaps:8/324 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINK 162
            |.|:.|||||||....|.:||.|||.| ||  .||.:.:..|:||||::..:|||:||||||.|:
 Frog   117 GGRKYFNFIADVAERTAPAVVNIEILD-RH--PFSRREVAVSSGSGFLVSPDGLIVTNAHVVANR 178

  Fly   163 PHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVN-NLSVMRLGKSSTLRSGEWVVALGSPLAL 226
              ..|:|:||:|.::.|.:.|||..:|:||::|... .|..:|||:|:.:|.||:|||:|||.:|
 Frog   179 --RRVRVKLSNGESYEAAVRDVDPATDIATIKINPKVPLPTLRLGRSAEIRQGEFVVAMGSPFSL 241

  Fly   227 SNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISF 291
            .||:|:|::||.||...||||.|||:.|:||||||.||||||||||||||.||:|:|||..||||
 Frog   242 QNTITSGIVSSVQRGGHELGLANRDMEYIQTDAAIDFGNSGGPLVNLDGEVIGINTMKVVPGISF 306

  Fly   292 AIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVL 356
            |||.|.|:.||:...::|.:||...:....:||:|:.||||||.||.|||.|..:.| :::||||
 Frog   307 AIPSDRVREFLQHGEKRRSQGSLLGSSEVKRRYIGVMMLTLTPKILAELKFRDPSFP-DVSHGVL 370

  Fly   357 VWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE 420
            :.|||||||||..||:.||:|..||.|....|.|:|||:..:.| |.:::.||.:.:.||:.||
 Frog   371 IHKVIVGSPAHESGLRAGDVVLEINAKRAMTSEDIYDAVHTHPK-LTMIVRRGSESLMVTVIPE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 169/324 (52%)
Trypsin_2 141..280 CDD:290102 79/139 (57%)
PDZ_serine_protease 323..417 CDD:238487 47/93 (51%)
htra2XP_031750958.1 degP_htrA_DO 125..>431 CDD:273938 162/312 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3820
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 317 1.000 Inparanoid score I2497
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm49269
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.