DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and LOC100331049

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_002665901.2 Gene:LOC100331049 / 100331049 -ID:- Length:301 Species:Danio rerio


Alignment Length:310 Identity:156/310 - (50%)
Similarity:225/310 - (72%) Gaps:19/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPA 179
            |..|:|    |||  .|||:.:..||||||||..:.||:||.|||.||  ..|.|:|::|.|:..
Zfish     4 DVAVHI----TRH--PFSGREVPISNGSGFIISSDDLIVTNGHVVANK--RGVCVKLTNGETYNT 60

  Fly   180 TIEDVDQTSDLATLRIQVNN-LSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQ 243
            |::||||.:|:||::|.|.| |..:||||||.:|.||:|||:||..:|.||:|:|::|..||.|:
Zfish    61 TVQDVDQAADIATIKINVKNPLPTLRLGKSSDVRQGEFVVAMGSLFSLKNTITSGIVSFAQRGSK 125

  Fly   244 ELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEK 308
            ||||.|.:::|:||||.|.||||||||:|||||.||:|:||||||||||||.|.|::|.:|:|:|
Zfish   126 ELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRLFFDRSADK 190

  Fly   309 RKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGG 370
            :|.   .|.:|     :||:|:.||||||.|:.||:.|..:.| :::||||:.:|||||||:..|
Zfish   191 QKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRDPSFP-DVSHGVLIHRVIVGSPANRAG 249

  Fly   371 LQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE 420
            ::|||::..||..::..|.::|:|:. .|::|::|:.||...:.:.:|||
Zfish   250 MKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLMLHMTPE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 156/310 (50%)
Trypsin_2 141..280 CDD:290102 80/139 (58%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)
LOC100331049XP_002665901.2 Trypsin_2 24..162 CDD:290102 80/139 (58%)
PDZ_serine_protease 203..287 CDD:238487 37/85 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.