DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-84o3.2

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_005161042.1 Gene:si:dkey-84o3.2 / 100330919 ZFINID:ZDB-GENE-091113-19 Length:209 Species:Danio rerio


Alignment Length:179 Identity:96/179 - (53%)
Similarity:138/179 - (77%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :||..:|.||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||:|||||.||:|:||
Zfish     1 MGSLFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346
            ||||||||||.|.|::||||:|:|:|.   .|.:|     :||:|:.||||||.|:.||:.|..:
Zfish    66 VTAGISFAIPSDRVRLFLERSADKQKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRDPS 125

  Fly   347 MPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDAL 395
            .| :::||||:.:|||||||:..|::|||::..||..::..|.::|:|:
Zfish   126 FP-DVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 96/179 (54%)
Trypsin_2 141..280 CDD:290102 37/59 (63%)
PDZ_serine_protease 323..417 CDD:238487 34/73 (47%)
si:dkey-84o3.2XP_005161042.1 Trypsin_2 <4..61 CDD:290102 35/56 (63%)
PDZ_serine_protease 102..>179 CDD:238487 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579615
Domainoid 1 1.000 70 1.000 Domainoid score I9474
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.