Sequence 1: | NP_001262565.1 | Gene: | HtrA2 / 41756 | FlyBaseID: | FBgn0038233 | Length: | 422 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335099.1 | Gene: | LOC100330882 / 100330882 | -ID: | - | Length: | 198 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 99/204 - (48%) |
---|---|---|---|
Similarity: | 151/204 - (74%) | Gaps: | 12/204 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
Fly 285 VTAGISFAIPIDYVKVFLERAAEKR---KKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346
Fly 347 MPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVK 411
Fly 412 QMHVTITPE 420 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HtrA2 | NP_001262565.1 | DegQ | 67..422 | CDD:223343 | 99/204 (49%) |
Trypsin_2 | 141..280 | CDD:290102 | 37/59 (63%) | ||
PDZ_serine_protease | 323..417 | CDD:238487 | 38/93 (41%) | ||
LOC100330882 | XP_021335099.1 | DegQ | <1..>175 | CDD:333159 | 91/182 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D238833at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |