DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and LOC100330882

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021335099.1 Gene:LOC100330882 / 100330882 -ID:- Length:198 Species:Danio rerio


Alignment Length:204 Identity:99/204 - (48%)
Similarity:151/204 - (74%) Gaps:12/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :|||.:|.||:|:|::||.||.|:||||...:::|:||||.|.||||||||:|||||.||:|:||
Zfish     1 MGSPFSLKNTITSGIVSSAQRDSKELGLSYSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKR---KKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346
            ||||||||||.|.|::||:|:.::.   :.||.       :||:|:.||||||.:|.:|:.|..:
Zfish    66 VTAGISFAIPTDRVRLFLDRSVDRSWFGESGSK-------RRYIGVMMLTLTPSVLIQLRMRDPS 123

  Fly   347 MPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVK 411
            .| :::||||:.:|||||||:..|::|||::..||..::..| ::|:|:. .|::|::|:.||..
Zfish   124 FP-DVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSXEIYNAVR-TSESLNVVVRRGAD 186

  Fly   412 QMHVTITPE 420
            .:.:.:|||
Zfish   187 LLMLHMTPE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 99/204 (49%)
Trypsin_2 141..280 CDD:290102 37/59 (63%)
PDZ_serine_protease 323..417 CDD:238487 38/93 (41%)
LOC100330882XP_021335099.1 DegQ <1..>175 CDD:333159 91/182 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.