DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:busm1-sl7.7

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021336609.1 Gene:si:busm1-sl7.7 / 100034638 ZFINID:ZDB-GENE-041001-38 Length:329 Species:Danio rerio


Alignment Length:326 Identity:166/326 - (50%)
Similarity:235/326 - (72%) Gaps:19/326 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FNFIADVVAG----CADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKP 163
            |.|.|.|..|    |...|..|.:...||  .|||:....||||||||..:|||:||||||.|| 
Zfish    12 FFFFATVFVGGAGLCLGIVTNITLFLFRH--PFSGREGPISNGSGFIISSDGLIVTNAHVVANK- 73

  Fly   164 HTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNN-LSVMRLGKSSTLRSGEWVVALGSPLALS 227
             ..|:|:|::|.|:.||::||||.:|:||::|.|.| |..:||||||.:|.||:|||:|||.:|.
Zfish    74 -RGVRVKLTNGETYNATVQDVDQVADIATIKINVKNPLPTLRLGKSSDVRQGEFVVAMGSPFSLK 137

  Fly   228 NTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFA 292
            ||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||:|||||.||:|:||||||||||
Zfish   138 NTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFA 202

  Fly   293 IPIDYVKVFLERAAEKRKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHG 354
            ||.|.|::||:|:|:|:|.   .|.:|     :||:|:.||||||.|:.||:.|..:.| :::||
Zfish   203 IPSDRVRLFLDRSADKQKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRDPSFP-DVSHG 261

  Fly   355 VLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITP 419
            ||:.:|||||||:..|::|||::..||..::..|.::|:|:. .|::|::|:.||...:.:.:||
Zfish   262 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLMLHMTP 325

  Fly   420 E 420
            |
Zfish   326 E 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 166/326 (51%)
Trypsin_2 141..280 CDD:290102 85/139 (61%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)
si:busm1-sl7.7XP_021336609.1 DegQ 41..>306 CDD:333159 148/273 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.