DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-33c12.13

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001098612.2 Gene:si:dkey-33c12.13 / 100003428 ZFINID:ZDB-GENE-081028-17 Length:200 Species:Danio rerio


Alignment Length:201 Identity:102/201 - (50%)
Similarity:153/201 - (76%) Gaps:4/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :|||.:|.||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||:|||||.||:|:||
Zfish     1 MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPS 349
            ||||||||||.|.|::||:|:|:|:|  |.:......:||:|:.||||||.|:.||:.|..:. :
Zfish    66 VTAGISFAIPSDRVRLFLDRSADKQK--SWFGESGSKRRYIGVMMLTLTPSIIEELRMRDPSF-A 127

  Fly   350 NLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMH 414
            :::||||:.:|||||||:..|:.|||::..||..::..|.::|:|:. .|::|::|:.||...:.
Zfish   128 DVSHGVLIHRVIVGSPANRAGMNPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLM 191

  Fly   415 VTITPE 420
            :.:|||
Zfish   192 LHMTPE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 102/201 (51%)
Trypsin_2 141..280 CDD:290102 38/59 (64%)
PDZ_serine_protease 323..417 CDD:238487 38/93 (41%)
si:dkey-33c12.13NP_001098612.2 DegQ <1..>177 CDD:333159 94/179 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11974
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.