DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HtrA2 and si:dkey-112g5.13

DIOPT Version :9

Sequence 1:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001103205.1 Gene:si:dkey-112g5.13 / 100003308 ZFINID:ZDB-GENE-081028-21 Length:200 Species:Danio rerio


Alignment Length:201 Identity:102/201 - (50%)
Similarity:152/201 - (75%) Gaps:4/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284
            :|||.:|.||:|:|::||.||.|:||||.|.:::|:||||.|.||||||||.|||||.||:|:||
Zfish     1 MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLTNLDGEVIGINTMK 65

  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPS 349
            ||||||||||...|::||:|:|:|:|  |.:......:||:|:.||||||.|:.||:.|..:.| 
Zfish    66 VTAGISFAIPSGRVRLFLDRSADKQK--SWFGESGSKRRYIGVMMLTLTPSIIKELRMRDLSFP- 127

  Fly   350 NLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMH 414
            :::||||:.:|||||||:..|::|||::..||..::..|.::|:|:. .|::|::|:.||...:.
Zfish   128 DVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGADLLM 191

  Fly   415 VTITPE 420
            :.:|||
Zfish   192 LHMTPE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 102/201 (51%)
Trypsin_2 141..280 CDD:290102 38/59 (64%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)
si:dkey-112g5.13NP_001103205.1 Trypsin_2 <1..61 CDD:290102 38/59 (64%)
PDZ_serine_protease 102..186 CDD:238487 37/85 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579602
Domainoid 1 1.000 70 1.000 Domainoid score I9474
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113300
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.