DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and BAG7

DIOPT Version :9

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_014777.3 Gene:BAG7 / 854302 SGDID:S000005660 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:61/246 - (24%)
Similarity:106/246 - (43%) Gaps:43/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1893 DKKVFGVPL---------LMILQRSGQ---TLPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMK 1945
            |.|||||.|         .:|:|:|..   ::|:.:..:.::|:.||||..||||.:|...|:.:
Yeast    44 DGKVFGVSLEESLKVAQEEVIIQKSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRE 108

  Fly  1946 LREQIEVTDSTAECMDVFDLQQAYDVADMLKQYFRELPESLLTTKMSETF-------VAIFQHLP 2003
            |:.............:.:.....:|:|.:||:|...|.|.|:...:.:.|       ..|.:|  
Yeast   109 LQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYDIFRNPILENPKINEH-- 171

  Fly  2004 AEVRLDAVQCAVLLLPDENREILYVLLEFLTIVAANSQQNQMTSNNLGVCLAQSIFHSSISTGSA 2068
            .|..:...:...:|||.:||.::..|...|.:.|.|.::|.|:::||...:..|:.         
Yeast   172 KEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLL--------- 227

  Fly  2069 SVSASPRRKGKGSGMPDMKELAEAKASHECLSFMIEHYKQIYTAAKEKLSK 2119
               :.|:         |.....|.:||...:.|:|.|...|.... ||.:|
Yeast   228 ---SHPK---------DEMCPKEYEASRTVIEFLILHASDIIPNT-EKANK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840 58/241 (24%)
SRPBCC 2148..2343 CDD:301327
BAG7NP_014777.3 RhoGAP_fSAC7_BAG7 47..257 CDD:239861 55/232 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46587
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3060
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.