DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and AT5G45560

DIOPT Version :10

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_199369.2 Gene:AT5G45560 / 834592 AraportID:AT5G45560 Length:719 Species:Arabidopsis thaliana


Alignment Length:149 Identity:30/149 - (20%)
Similarity:50/149 - (33%) Gaps:39/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MMHVGAASIQSCLFLPNVMLNGGTVDEFQTDDITQCCVQCSSSSCCIAYTYDTVKKRCYLKNAIG 75
            |.|.|.... ||:.......|...:|..|.....:....||....|.:       ::.:||  |.
plant   401 MTHTGKKPF-SCVECEKCFSNYSELDRHQMTHTGEKPFSCSECGKCFS-------RQSHLK--IH 455

  Fly    76 FSTEDFSKTSGLKPNSRY--GKGVTLKNVKILGDQTNRVELRSEEECRQYCTAYQVFSWGPPNHD 138
            :.|.     :|.||.|.:  ||..::::..   |:..|:.           |..:.||..     
plant   456 YRTH-----TGEKPFSCFECGKCFSVESEL---DRHQRIH-----------TGEKPFSCS----- 496

  Fly   139 QMIRSGECVCTMRIKSLSY 157
               ..|:|:.|.....:.|
plant   497 ---ECGKCISTQSHLKIHY 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840
SRPBCC 2148..2343 CDD:472699
AT5G45560NP_199369.2 PLN00188 1..719 CDD:215094 30/149 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.