DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and AT5G35180

DIOPT Version :10

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_001154747.1 Gene:AT5G35180 / 833472 AraportID:AT5G35180 Length:811 Species:Arabidopsis thaliana


Alignment Length:71 Identity:13/71 - (18%)
Similarity:28/71 - (39%) Gaps:16/71 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LKNAIGFSTED---FSKTSGLKPNSRYGKGVTLKNVK---ILGDQTNRVELRS----------EE 118
            |...:.|:.||   :.....|..:..:..|:..:::|   ||.|:...::|..          |:
plant   132 LSKEVMFTEEDVKFYLAELALALDHLHSLGIVYRDLKPENILLDEAGHIKLTDFGLSKESVDHEK 196

  Fly   119 ECRQYC 124
            :...:|
plant   197 KAYSFC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840
SRPBCC 2148..2343 CDD:472699
AT5G35180NP_001154747.1 PLN00188 60..807 CDD:215094 13/71 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.