DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and AT2G28320

DIOPT Version :10

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_180399.2 Gene:AT2G28320 / 817379 AraportID:AT2G28320 Length:737 Species:Arabidopsis thaliana


Alignment Length:224 Identity:51/224 - (22%)
Similarity:92/224 - (41%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  2134 EALGEGMQFHNWRGYLYECT---------SATIKEGREKTRGWFSINS--LNDSSVDIA----YK 2183
            ||..:|..|   .|.::.|:         |:::::....:..|...:|  ::..:.|:.    :.
plant   115 EAALKGAPF---PGDVFNCSRSRWDSLRLSSSVRDHHSNSIDWTLRSSARVDPVTTDVVAPSPWT 176

  Fly  2184 KVGDGHPLRLWRCSTE------------------IEGPPKEVLEFVIK---QRASWDTNLLQCQT 2227
            ..|..:.|||::.:.|                  ::|..:.:.:.::.   .|:.||....|...
plant   177 IFGCQNGLRLFKEAKERDSLGRWDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSV 241

  Fly  2228 VKKLDDRTEIYQYALD------GQLTTDFCVLRSWQTDLPRGACVIVETSIDHAKAKPLFGAVRG 2286
            |:.||..|:|....|.      |....||.:.|.|:.: ..|..||:..|:.|.|..|..|.||.
plant   242 VEHLDGHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRRE-DDGTYVILYHSVFHKKCPPQKGYVRA 305

  Fly  2287 VVLASRYLIEPCGSGR-SRVMHLARVDVK 2314
            .:.:..|:|.|..:|: |.|.|:..||.|
plant   306 CLKSGGYVISPIDNGKQSVVKHMLAVDWK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840
SRPBCC 2148..2343 CDD:472699 46/210 (22%)
AT2G28320NP_180399.2 PLN00188 14..733 CDD:215094 51/224 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.