DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and Arhgap40

DIOPT Version :9

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:XP_008760659.2 Gene:Arhgap40 / 296323 RGDID:1562428 Length:92 Species:Rattus norvegicus


Alignment Length:75 Identity:22/75 - (29%)
Similarity:35/75 - (46%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1653 RTPTTPRSMRTSPLHFFS---SPMSQLKEGKSDDSSSYYSDSQESSTGGKLSLRKPSKARRFLQR 1714
            :.|.:|.:..|..|..|:   :|.||.:|| |:.|:|..||:.:         :||  |...:..
  Rat     5 QVPLSPSTRVTHVLKLFTEHLNPGSQPEEG-SETSNSLLSDNTK---------KKP--ATFLVYE 57

  Fly  1715 TGKVDDIGAH 1724
            .|  .:||.|
  Rat    58 VG--GNIGEH 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840
SRPBCC 2148..2343 CDD:301327
Arhgap40XP_008760659.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.