powered by:
Protein Alignment cv-c and Arhgap40
DIOPT Version :9
Sequence 1: | NP_001097786.1 |
Gene: | cv-c / 41749 |
FlyBaseID: | FBgn0285955 |
Length: | 2351 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008760659.2 |
Gene: | Arhgap40 / 296323 |
RGDID: | 1562428 |
Length: | 92 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 22/75 - (29%) |
Similarity: | 35/75 - (46%) |
Gaps: | 17/75 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1653 RTPTTPRSMRTSPLHFFS---SPMSQLKEGKSDDSSSYYSDSQESSTGGKLSLRKPSKARRFLQR 1714
:.|.:|.:..|..|..|: :|.||.:|| |:.|:|..||:.: :|| |...:..
Rat 5 QVPLSPSTRVTHVLKLFTEHLNPGSQPEEG-SETSNSLLSDNTK---------KKP--ATFLVYE 57
Fly 1715 TGKVDDIGAH 1724
.| .:||.|
Rat 58 VG--GNIGEH 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.