DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-c and arhgap18

DIOPT Version :9

Sequence 1:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster
Sequence 2:XP_001343601.7 Gene:arhgap18 / 100004252 ZFINID:ZDB-GENE-070502-1 Length:672 Species:Danio rerio


Alignment Length:408 Identity:93/408 - (22%)
Similarity:173/408 - (42%) Gaps:79/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1764 PKKRDGFRSSSFRSRSTSRKEAKNDEDTAGATTNGGSKRQPV----------------------- 1805
            |..|:.|:.      ||:...:|.||  |.:|...|||:|.|                       
Zfish   187 PDVREIFKP------STTAAHSKQDE--AESTERSGSKKQEVEGLGNGVGLIAAGGGADTETDIN 243

  Fly  1806 ----VRWHSFQMEERPNMIFRKCFSKKIEP----LQEDAGGMPFAAMSAGQLQIIRKLALVTLTG 1862
                ....:...:|...:...:|.:....|    .|:..|......:||..::.:|:|.|:.::.
Zfish   244 LEVSFSEQALVYKEELKLSKPQCQADDRLPDFKVSQDKTGQTKVGDLSAEDMKKVRRLVLIEMSA 308

  Fly  1863 HMERYC----PSHRSGWNWELPKFIKKIKMPDYKDKKVFGVPLLMILQRS-----GQTLPLAVRA 1918
            ..:. |    .:|::          .|:|:   ::..:|||||.::|.:.     |..:||.::.
Zfish   309 LFDT-CGVEVKAHKA----------LKVKV---RESGLFGVPLSVLLDQDQRRIPGTKVPLILQH 359

  Fly  1919 AFRWLQLNALDQVGIFRKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDVADMLKQYFRELP 1983
            ....::...||..|:.|..|..:|:..:..::|  ....|.:..::..:.:|.|.:||.:.||||
Zfish   360 LISHIEEQGLDTEGVLRIPGAATRVKAVCHELE--HKFYEGLFPWESLKQHDAASLLKLFIRELP 422

  Fly  1984 ESLLTTKMSETFVAIFQHLPAEVRLDAVQCAVLLLPDENREILYVLLEFLTIVAANSQQNQMTSN 2048
            ..|||.:....|:::.:....:.:|.|:...|||||:.||:.|..|:||...|..:..:|:||.|
Zfish   423 YPLLTVQYFNAFISVLKLPTQKQQLQALNLLVLLLPEHNRDTLKALMEFFQRVIHHKDKNKMTLN 487

  Fly  2049 NLGVCLAQSIFHSSISTGSASVSASPRRKGKGSGMPDMKELAEAKASHECLSFMIEHYKQIYTAA 2113
            |:.|.:|.:||..               ||..|.:.:.:|.|.|..:...:..:|.:...::|..
Zfish   488 NVAVVMAPNIFMC---------------KGFRSKISEQQEFAMATGTANIVRLLIRYQNLLWTIP 537

  Fly  2114 KEKLSKCNFSYMEESKPL 2131
            |..|::.....||..:.:
Zfish   538 KFILNQVRKHNMENQRKM 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840 61/227 (27%)
SRPBCC 2148..2343 CDD:301327
arhgap18XP_001343601.7 RhoGAP_ARHGAP18 332..545 CDD:239856 62/229 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.