DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and hmx1

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001106998.1 Gene:hmx1 / 797503 ZFINID:ZDB-GENE-080204-54 Length:282 Species:Danio rerio


Alignment Length:247 Identity:66/247 - (26%)
Similarity:109/247 - (44%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 KKERPEVAFDAQGPAKSPNSILKPYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAAT 269
            |.::...:..::|.:....::|...:.::|:  ..|..:|.:|..:|......:........|::
Zfish     4 KSQQQHTSTTSRGSSFFIENLLGSCRTEKPV--CPIKDNDGTERANALKRYPNAYRKEMCVQASS 66

  Fly   270 ITAATVATPLDQPLNLCVVKKSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSSTVAL 334
            ....|..:||:.        |.|:::.||...::.|....:|......:.:|      |...|  
Zfish    67 AGFKTEISPLEW--------KGRETSRSPREESRNSSEYSRSDRDTPLASEP------LDGVV-- 115

  Fly   335 PPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTT 399
                           |:.|:..:...|.:........:.      .|.|:.||.   ||||.||.
Zfish   116 ---------------DRKMSGCAVDEGDDARQLFDERSG------PDTSEPGSA---RKKKTRTV 156

  Fly   400 FTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQ 451
            |:..|:|:||..|:.|:|||:|||..:|..|.:|||||||||||||.|||:|
Zfish   157 FSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 31/51 (61%)
hmx1NP_001106998.1 Homeobox 153..206 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.