DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and hmx3

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001072829.1 Gene:hmx3 / 780290 XenbaseID:XB-GENE-483776 Length:306 Species:Xenopus tropicalis


Alignment Length:189 Identity:65/189 - (34%)
Similarity:90/189 - (47%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PD----ISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANST-------LETTEDD----SDS 385
            ||    :.||.......||      |..|...:.|::::..:.:       ||.:|.:    .||
 Frog   102 PDKSLLLGPTSPVSGGERD------SPEPIHPLKAELEAKDSESKSPEEIILEESEPEEGKKDDS 160

  Fly   386 G--------STDAR--RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIW 440
            |        |.|.:  ||||.||.|:..|:|:||..|:.|:|||:|||..:|..|.:||||||||
 Frog   161 GEDWKKREESPDKKPCRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIW 225

  Fly   441 FQNRRTKWKKQDNVTNNEAAEHKSSNAKPGATGTATTTP-----SGEPTDKRSSNATSP 494
            |||||.|||:|      .|||.:::|....|.......|     :....:..||.|..|
 Frog   226 FQNRRNKWKRQ------LAAELEAANLSHAAAQRIVRVPILYHENSSSAESASSAANVP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 31/51 (61%)
hmx3NP_001072829.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..181 20/84 (24%)
Homeobox 181..235 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.