DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and hmx4

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001038836.2 Gene:hmx4 / 751654 ZFINID:ZDB-GENE-060825-142 Length:238 Species:Danio rerio


Alignment Length:198 Identity:56/198 - (28%)
Similarity:90/198 - (45%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 TKKESSGKPAAKK--------------------KKLSSTVALPPDISPTGSSDSLMR-------- 349
            :|:::|.:||:.|                    .:.|..|.....:...|.|:...:        
Zfish     2 SKEDASCRPASLKFTIDNILNSKTSSRNFDSCHSRASLVVCRDGCLHHPGESEDPCKEGSDARLH 66

  Fly   350 --DKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMF 412
              |||.....::..:.....|:|.:..:.:..:..::........|||.||.|:.||||:||..|
Zfish    67 GIDKLNREGDATVDALKAVDMRSESADSCDDAQQKNNGKKNKLMTKKKTRTIFSKRQIFQLESTF 131

  Fly   413 ENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAKPGATGTATT 477
            :.|:|||::||..:|..|.:|||||||||||||.|.|:|      .:.|.:..|::.|..|....
Zfish   132 DMKRYLSSAERACLANSLQLTETQVKIWFQNRRNKLKRQ------LSTELEGPNSEFGDIGKTVP 190

  Fly   478 TPS 480
            .|:
Zfish   191 LPA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 32/51 (63%)
hmx4NP_001038836.2 Homeobox 115..168 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.