Sequence 1: | NP_001247103.1 | Gene: | NK7.1 / 41747 | FlyBaseID: | FBgn0024321 | Length: | 721 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038836.2 | Gene: | hmx4 / 751654 | ZFINID: | ZDB-GENE-060825-142 | Length: | 238 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 56/198 - (28%) |
---|---|---|---|
Similarity: | 90/198 - (45%) | Gaps: | 36/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 313 TKKESSGKPAAKK--------------------KKLSSTVALPPDISPTGSSDSLMR-------- 349
Fly 350 --DKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMF 412
Fly 413 ENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAKPGATGTATT 477
Fly 478 TPS 480 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NK7.1 | NP_001247103.1 | Homeobox | 397..449 | CDD:278475 | 32/51 (63%) |
hmx4 | NP_001038836.2 | Homeobox | 115..168 | CDD:278475 | 32/52 (62%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0485 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.770 |