DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Nkx6-3

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_083278.1 Gene:Nkx6-3 / 74561 MGIID:1921811 Length:262 Species:Mus musculus


Alignment Length:213 Identity:70/213 - (32%)
Similarity:90/213 - (42%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 KLSSTVALPPDI-------SPTGSSDSLMRDKLMANNS--------------SSPGSNVNAQMQS 370
            |||     ||.:       :|.|.:|.|.|.....|:|              ||.|.....|:.|
Mouse    37 KLS-----PPGLGPQLAAGTPHGITDILSRPVATPNSSLLSGYPHVAGFGGLSSQGVYYGPQVGS 96

  Fly   371 -----------NANSTLETTED----------DSDSGSTDARRKKKARTTFTGRQIFELEKMFEN 414
                       ..|...:|.:|          ..|..|....:||..|.||||.|||.|||.||.
Mouse    97 FSKAGNEYPTRTRNCWADTGQDWRGSARPCSNTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQ 161

  Fly   415 KKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS--NAKPGATGTATT 477
            .|||:..||..:|..|.:||:|||:|||||||||:|:      .|.|..||  .|..||:|....
Mouse   162 TKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKK------SALEPSSSTPRAPGGASGDRAA 220

  Fly   478 TPS-----GEPTDKRSSN 490
            :.:     .:|.|..|.:
Mouse   221 SENEDDEYNKPLDPDSDD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 33/51 (65%)
Nkx6-3NP_083278.1 Homeobox 143..197 CDD:395001 34/53 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..237 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.