DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Nanog

DIOPT Version :10

Sequence 1:NP_650357.2 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:165 Identity:32/165 - (19%)
Similarity:59/165 - (35%) Gaps:52/165 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 IRKEMFYP-GEVLND---------IQIIDQVFAQIVEDCKKSYPYRIREQDRKQVETVLRQYEIP 548
            :|..:..| ||.||:         ...|:.::..|.:.|         .:|...|.:...:||..
Mouse    41 LRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFC---------SEDSCPVMSAGPKYEYH 96

  Fly   549 PSDLNNQSNIHPDVKVAVIELARLWPLYFNQVYEVVEKRPDESVSTIFAISEHGIRLIVHTPHDL 613
            .:|   .:||...:|.:.       |.:.:.:...|:.:.|:  .|:|                 
Mouse    97 WAD---GTNIKKPIKCSA-------PKFIDYLMTWVQDQLDD--ETLF----------------- 132

  Fly   614 ENPLKIQDFFP--FETIADVSLEANDILSVHVRHE 646
              |.||...||  |.::|...|:....:..|:.|:
Mouse   133 --PSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_650357.2 Homeodomain 394..450 CDD:459649
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 11/57 (19%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 17/89 (19%)
Homeodomain 98..153 CDD:459649 16/85 (19%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 10/49 (20%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.