DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and NKX3-1

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_006158.2 Gene:NKX3-1 / 4824 HGNCID:7838 Length:234 Species:Homo sapiens


Alignment Length:218 Identity:63/218 - (28%)
Similarity:95/218 - (43%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 ATITAATVATPLDQPLNLCVVKK-SRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSST 331
            |....|...|| .:||...:::. .||.      |.:|.   |:::::::...:|          
Human    12 AKAEGAAPPTP-SKPLTSFLIQDILRDG------AQRQG---GRTSSQRQRDPEP---------- 56

  Fly   332 VALPPDISPTG--SSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGS------- 387
               .|:..|.|  |......|:|.....::|          ....||..||.:...||       
Human    57 ---EPEPEPEGGRSRAGAQNDQLSTGPRAAP----------EEAETLAETEPERHLGSYLLDSEN 108

  Fly   388 ----------TDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQ 442
                      |..:.:|::|..|:..|:.|||:.|.::|||||.||..:||.|.:||||||||||
Human   109 TSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQ 173

  Fly   443 NRRTKWK-KQDNVTNNEAAEHKS 464
            |||.|.| ||.:....:..:|.|
Human   174 NRRYKTKRKQLSSELGDLEKHSS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 31/51 (61%)
NKX3-1NP_006158.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 28/151 (19%)
Homeobox 127..180 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.