DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and ro

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:252 Identity:68/252 - (26%)
Similarity:103/252 - (40%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDS 385
            |....:|| |.|:.||.|:..|:::.::.....|...|.|      ...:..::.|         
  Fly   133 PQLVHQKL-SYVSPPPAIAAGGAANPVLPHAFPAGFPSDP------HFSAGFSAFL--------- 181

  Fly   386 GSTDARRKKK------ARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNR 444
                |||::|      .||||:..|...||..|...:|:|.|.|.|:|:.|.:||||:|||||||
  Fly   182 ----ARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNR 242

  Fly   445 RTKWKK------QDNVTNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPTVGNAATIA 503
            |.|.|:      ..:..|...|....|:....|   |||.|.|..|...:..........|||.|
  Fly   243 RAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQA---ATTMPPGGVTGGVAVGVGLNYYAAAATPA 304

  Fly   504 EIKKSPKSPNRGSNNNNNNTLNNNVNNSEGKVPAKQSTTKIKKQLNALLEKTVKTAN 560
            .:.|             :||.:.|..:.:.:...:|...:.::|......:|....|
  Fly   305 ALPK-------------DNTQDANFIDIDDQFQRQQQQKQQQQQQQQRRRETTTPIN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 28/51 (55%)
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.