DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and bap

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:295 Identity:88/295 - (29%)
Similarity:124/295 - (42%) Gaps:82/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 TPHSIADILGMSFVKKERPEVAFDAQGPAKSPNSILKPYQEQQPIRSSSIS------------MS 243
            ||.||.|||..|..:..|.........|.|     |||..:::  ||.|.|            ::
  Fly    22 TPFSINDILTRSNPETRRMSSVDSEPEPEK-----LKPSSDRE--RSISKSPPLCCRDLGLYKLT 79

  Fly   244 DASEEESAAVAGATSAATAAAAVAATITAATVATPLDQPLN-LCVVKKSRDSNNSPMPATKQSQI 307
            ...|.:.:|                           .||.| |.....:.|:||....||..|  
  Fly    80 QPKEIQPSA---------------------------RQPSNYLQYYAAAMDNNNHHHQATGTS-- 115

  Fly   308 LGKSATKKESSGKPAAKKKKLS---STVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQ 369
                     :|......::||:   ||:|.|.|:....|:||         :..||        .
  Fly   116 ---------NSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDS---------DCDSP--------P 154

  Fly   370 SNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTE 434
            ..::|..|:......||.:   |||::|..|:..|:||||:.|..::|||..||:||||.|.:||
  Fly   155 PLSSSPSESPLSHDGSGLS---RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTE 216

  Fly   435 TQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAKP 469
            |||||||||||.|.|:: .:..:|||...:|...|
  Fly   217 TQVKIWFQNRRYKTKRK-QIQQHEAALLGASKRVP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 32/51 (63%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442246
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.