Sequence 1: | NP_001247103.1 | Gene: | NK7.1 / 41747 | FlyBaseID: | FBgn0024321 | Length: | 721 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997995.2 | Gene: | nkx1.2la / 405755 | ZFINID: | ZDB-GENE-040615-1 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 246 | Identity: | 62/246 - (25%) |
---|---|---|---|
Similarity: | 95/246 - (38%) | Gaps: | 81/246 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 KESSGKPAAKKKKLSSTV-ALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLET 378
Fly 379 TEDDSD---------------------------SG----------------------STDARRK- 393
Fly 394 -------KKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQ 451
Fly 452 DNVTNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPTVGNAATI 502 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NK7.1 | NP_001247103.1 | Homeobox | 397..449 | CDD:278475 | 30/51 (59%) |
nkx1.2la | NP_997995.2 | Homeobox | 145..197 | CDD:278475 | 30/51 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576038 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |