DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and CG34031

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:209 Identity:63/209 - (30%)
Similarity:86/209 - (41%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 LNLCVVKKSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSL 347
            ||.|:.|..:......:.|.....||..|...              ||..:||.|.:...|||. 
  Fly    12 LNSCIEKSIQTKKKGKLGAFSIDSILSTSEAH--------------SSQNSLPKDNTNVTSSDI- 61

  Fly   348 MRDKLMANNSSSPGSN----VNAQMQSNANSTLETTEDDSD----------------SGSTDARR 392
              .||.|.:.:..|:|    .|..:.......|..|.|.|.                :.||:.:.
  Fly    62 --SKLYAFSFTQEGNNKTPLTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQE 124

  Fly   393 K--------KKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWK 449
            |        :|.|..::..|:..||..|...||||.|:|.|::|.|.:||.|||.||||||||||
  Fly   125 KQLRKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWK 189

  Fly   450 KQDNVTNNEAAEHK 463
            ||  :|:.....|:
  Fly   190 KQ--LTSRLKIAHR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.