DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and lms

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:405 Identity:108/405 - (26%)
Similarity:159/405 - (39%) Gaps:73/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDA-- 390
            :...:|.|...|.|...||:       .:.|..|.|.....::::.:|....:|:.|.|.:|.  
  Fly    16 IEQILAKPEMRSSTSFEDSV-------QDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDL 73

  Fly   391 ----------RRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRR 445
                      .|||:.||.|:..||..||..||..||||.::||.:||.|.:||||:||||||||
  Fly    74 ASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRR 138

  Fly   446 TKWKKQDNVTNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPT---------VGNAAT 501
            ||||::........|.|  ..|:.|..|.|.....|:.....|...|.||         .|:||.
  Fly   139 TKWKRKYTSDVETLASH--YYAQLGIGGLARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAP 201

  Fly   502 IAEIKKSPKSPNRGSNNNNNNTLNNNVNNSEGKVPAKQSTTKIKKQLNALLEKTVKTANQAHRSA 566
            :|....:..||.|             ...:.|.:|.....:.::...||:|.:. :..|.|    
  Fly   202 MASATTATGSPMR-------------PYATSGGMPPLPGPSVMESARNAILARG-QPLNFA---- 248

  Fly   567 ELESSDQKPAVEKRPNNSNENQLLHQRLHQHAIPLTVEPAAPLEQTEK-LDIKREESPQHRELQL 630
             |.....||.....|..|     ...|...:|... |:.||.|...|. |.:|....|...|   
  Fly   249 -LPFGVAKPPAGGVPAAS-----YIPRCKPYATSY-VDYAASLPTNESYLQMKYATLPPEAE--- 303

  Fly   631 SLQRAAIQNGQLTEMD---------FESKLAASKISIALAMANKQMQPEKRVKTESSSSEGEGDG 686
                :...|| |.|::         |..:.:......|.|..:..:...:|.:..:.|.....|.
  Fly   304 ----SGASNG-LAELERVFGDANANFLQQRSTPVAGTATAYGHDGLNQAQRSRRPTQSESECSDI 363

  Fly   687 DGEEEEEEEEVSSSE 701
            |.|..:|:||..::|
  Fly   364 DCEHLDEDEEPPAAE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 32/51 (63%)
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 20/79 (25%)
Homeobox 89..142 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.