DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Nkx2-6

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001121125.1 Gene:Nkx2-6 / 364418 RGDID:1306149 Length:213 Species:Rattus norvegicus


Alignment Length:128 Identity:45/128 - (35%)
Similarity:62/128 - (48%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTT 399
            |..|||.| .::||.:..:.|.|..|..                    :....|..|.::|.|..
  Rat    13 PGTISPLG-VENLMMEHGVGNRSDDPRR--------------------AGPVPTVTRPRRKPRVL 56

  Fly   400 FTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEH 462
            |:..|:..||:.|:.::||||.||..:|.:|.:|.|||||||||||.|.|:|......|.|.|
  Rat    57 FSQAQVLALERRFKQQRYLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLELAGH 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)
Nkx2-6NP_001121125.1 Homeobox 53..107 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.