DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and eve

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:162 Identity:46/162 - (28%)
Similarity:71/162 - (43%) Gaps:43/162 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 KSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMA 354
            :|..:::...|..::..::...||:   .|||..           ||. ||   ::.|       
  Fly    10 ESHHAHHDASPVDQKPLVVDLLATQ---YGKPQT-----------PPP-SP---NECL------- 49

  Fly   355 NNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLS 419
               |||.:::|....|      |...|.|         .::.||.||..|:..|||.|..:.|:|
  Fly    50 ---SSPDNSLNGSRGS------EIPADPS---------VRRYRTAFTRDQLGRLEKEFYKENYVS 96

  Fly   420 ASERTEMAKLLMVTETQVKIWFQNRRTKWKKQ 451
            ...|.|:|..|.:.|:.:|:||||||.|.|:|
  Fly    97 RPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 24/51 (47%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.