DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and pnx

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:141 Identity:48/141 - (34%)
Similarity:70/141 - (49%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 KLSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDAR 391
            |.|.::|   ||......:.....:.::||..||         ...:.|.|.:..:..:.|....
Zfish    13 KTSFSIA---DILDPAKFNGTRETREISNNRESP---------KTTSPTQEPSAPNIANASAAKV 65

  Fly   392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTN 456
            :.|:.||.||..|:..||:.|::..|||..||..:|..|.::|||||||||||||||||:.:...
Zfish    66 KSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKKELDGHG 130

  Fly   457 NEAAEHKSSNA 467
            .|...|.:..|
Zfish   131 GEEQSHCAPTA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 7/47 (15%)
Homeobox 71..123 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.