DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and HMX3

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001099044.1 Gene:HMX3 / 340784 HGNCID:5019 Length:357 Species:Homo sapiens


Alignment Length:387 Identity:105/387 - (27%)
Similarity:146/387 - (37%) Gaps:112/387 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PGPPTNWHAHVYDRLPPHPTPHSIADILGMSFVKKERPEVAFDAQGPAKSPNSILK--------- 227
            |||.....|....:.||.|.|                        .|.:||.||..         
Human     4 PGPDAAGTASAQPQPPPPPPP------------------------APKESPFSIKNLLNGDHHRP 44

  Fly   228 PYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLDQPLNLCVVKKSR 292
            |.:.|.|.|:..         ..|:.|.|.:||.||||..|...||..|  |.|..:|...:...
Human    45 PPKPQPPPRTLF---------APASAAAAAAAAAAAAAKGALEGAAGFA--LSQVGDLAFPRFEI 98

  Fly   293 DSNNSPMPA--TKQSQILGKSATKKESSG---KPAAKKKKLSSTVALPPDISPTGSSDSLMRDKL 352
            .:....:||  .::|.......|...:.|   :|.|.:|      ||..|.||...:|   ||  
Human    99 PAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEK------ALLRDSSPASGTD---RD-- 152

  Fly   353 MANNSSSPGSNVNA-----QMQSNANSTLETTEDDSDS-----------------------GSTD 389
                  ||...:.|     ::.|.:...:...|.||:.                       |:.|
Human   153 ------SPEPLLKADPDHKELDSKSPDEIILEESDSEESKKEGEAAPGAAGASVGAAAATPGAED 211

  Fly   390 ------------ARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQ 442
                        |.||||.||.|:..|:|:||..|:.|:|||:|||..:|..|.:||||||||||
Human   212 WKKGAESPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQ 276

  Fly   443 NRRTKWKKQDNVTNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPTVGNAATIAE 504
            |||.|||:|      .|||.:::|....|.......|.....:..:..|.:...|....:::
Human   277 NRRNKWKRQ------LAAELEAANLSHAAAQRIVRVPILYHENSAAEGAAAAAAGAPVPVSQ 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 31/51 (61%)
HMX3NP_001099044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 17/86 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..229 23/116 (20%)
Homeobox 230..283 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.