DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and HMX2

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_005510.1 Gene:HMX2 / 3167 HGNCID:5018 Length:273 Species:Homo sapiens


Alignment Length:275 Identity:79/275 - (28%)
Similarity:116/275 - (42%) Gaps:86/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GPAKSPNSILKPYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLD- 280
            ||:::|...:     ..|.|..|:|:|  ||||.                           |.| 
Human    29 GPSEAPREPV-----GWPARKRSLSVS--SEEEE---------------------------PDDG 59

  Fly   281 --QPLNLCV----VKKSRDSNNSPMPATKQSQILGKSATKKESSGK-PAAKKKKLSSTVALPPDI 338
              .|...|.    .|:....::.|:|    ...||   |.|.|.|. |...::        .|.:
Human    60 WKAPACFCPDQHGPKEQGPKHHPPIP----FPCLG---TPKGSGGSGPGGLER--------TPFL 109

  Fly   339 SPTGSSDSLMRDKLMANNSSSPGS----NVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTT 399
            ||:.|.....:::|:...|.||||    :..|:.|:.|                   .|||.||.
Human   110 SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGA-------------------AKKKTRTV 155

  Fly   400 FTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKS 464
            |:..|:::||..|:.|:|||:|||..:|..|.:||||||.||||||.|||:|      .:||.::
Human   156 FSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQ------LSAELEA 214

  Fly   465 SNAKPGATGTATTTP 479
            :|....:..|..:.|
Human   215 ANMAHASAQTLVSMP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)
HMX2NP_005510.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 41/190 (22%)
Homeobox 152..205 CDD:306543 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.