DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and nkx2.2a

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:219 Identity:65/219 - (29%)
Similarity:98/219 - (44%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLDQPLNLCVVKKSRDSNNSPMPATK- 303
            :.:.|.::|| .::.| |...|..:....| ....|.:||:...||.:  |:...:||..|.|: 
Zfish    20 LDLPDTNDEE-GSITG-TEEDTEGSEATKT-PGVLVQSPLENVQNLPL--KNPFYDNSDNPYTRW 79

  Fly   304 -------QSQILGKSATKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMANNSSSPG 361
                   |..:.|.||..:::|.|                  ||..|:|            .|| 
Zfish    80 LATTDSIQYSLHGLSANSQDTSAK------------------SPEPSAD------------ESP- 113

  Fly   362 SNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEM 426
                       ::..||:.:.||||     :|:|.|..|:..|.:|||:.|..::||||.||..:
Zfish   114 -----------DNDKETSSNGSDSG-----KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHL 162

  Fly   427 AKLLMVTETQVKIWFQNRRTKWKK 450
            |.|:.:|.|||||||||.|.|.|:
Zfish   163 ASLIRLTPTQVKIWFQNHRYKMKR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 46/141 (33%)
Homeobox 132..185 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.