DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and nkx2.7

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:196 Identity:61/196 - (31%)
Similarity:87/196 - (44%) Gaps:36/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 SSPGSNVNAQMQSNANSTLETTEDDSDS---GST-----DARRKKKARTTFTGRQIFELEKMFEN 414
            ||.||....:|.:|..:::....|.|.|   |.|     ..|.::|.|..|:..|:||||:.|:.
Zfish    81 SSCGSPTEEEMDANEETSMCPFTDSSYSSKNGETLREKPKQRLRRKPRVLFSQTQVFELERRFKQ 145

  Fly   415 KKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSN-AKPGATGTATTT 478
            ::||||.||..:|..|.:|.|||||||||||.|.|:|        .:.||.. |.|.........
Zfish   146 QRYLSAPERDHLALALKLTSTQVKIWFQNRRYKCKRQ--------RQDKSLELAGPRRVAVPVLV 202

  Fly   479 PSGEPTDKRSSNATSPTVGNAATIAEIKKSPKSPNRGSNNNNNNTLNNNVNNSEGKVPAKQSTTK 543
            ..|:|......|.|                   .:...||..|:..||..:.:...||:..:|::
Zfish   203 RDGKPCHGAPYNVT-------------------VSYPYNNYYNSYGNNPYHCNFTSVPSFANTSQ 248

  Fly   544 I 544
            |
Zfish   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 46/130 (35%)
Homeobox 127..180 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.