DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and pou5f3

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_571187.1 Gene:pou5f3 / 30333 ZFINID:ZDB-GENE-980526-485 Length:472 Species:Danio rerio


Alignment Length:446 Identity:90/446 - (20%)
Similarity:135/446 - (30%) Gaps:148/446 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSPLTIPPTSMTTHMVSPIGNSKEKLVNMLRVRDNNNMA--STISDSPPTTFLQKQLEAVVAPRP 139
            :.|..|.|         |||.::|::.....|:...::.  ....:.||:   |..|.|..:..|
Zfish   109 TQPANISP---------PIGETREQIKMPSEVKTEKDVEEYGNEENKPPS---QYHLTAGTSSVP 161

  Fly   140 SSV------HPQ-----HQQPQQQTVQLQQQRRSVSTPAITTTPGPPTNWHAHVYDRLPPHPTPH 193
            :.|      :|.     .|...|..:.......|.|:|::  :|.||.|...          :| 
Zfish   162 TGVNYYTPWNPNFWPGLSQITAQANISQAPPTPSASSPSL--SPSPPGNGFG----------SP- 213

  Fly   194 SIADILGMSFVKKERPEVAFDAQGPAKS-PNSILKPYQEQQPIRSSSIS---MSDASEEESAAVA 254
                              .|.:.|.|:: |::     |.|...|||..|   .||:.|||:....
Zfish   214 ------------------GFFSGGTAQNIPSA-----QAQSAPRSSGSSSGGCSDSEEEETLTTE 255

  Fly   255 GATSAATAAAAVAATI--TAATVATPLDQPLNLCVVKKSRDSNNSPMPATKQSQILGKSATKK-- 315
            .....|........|:  |.|.|...|                         ..:.||..::.  
Zfish   256 DLEQFAKELKHKRITLGFTQADVGLAL-------------------------GNLYGKMFSQTTI 295

  Fly   316 ------ESSGKPAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANS 374
                  :.|.|...|.|.|                  |.|....|.||.:|     ..|......
Zfish   296 CRFEALQLSFKNMCKLKPL------------------LQRWLNEAENSENP-----QDMYKIERV 337

  Fly   375 TLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKI 439
            .::|             ||:|.||:..|.....||..|......:..|.|.::..|.:....|::
Zfish   338 FVDT-------------RKRKRRTSLEGTVRSALESYFVKCPKPNTLEITHISDDLGLERDVVRV 389

  Fly   440 WFQNRRTKWKKQDNVTNNEAAE------------HKSSNAKPGATGTATTTPSGEP 483
            ||.|||.|.|:.....::|..|            |......||........|.|.|
Zfish   390 WFCNRRQKGKRLALPFDDECVEAQYYEQSPPPPPHMGGTVLPGQGYPGPAHPGGAP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 16/51 (31%)
pou5f3NP_571187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..154 4/29 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..255 23/103 (22%)
POU 259..323 CDD:197673 15/106 (14%)
Homeobox 346..399 CDD:278475 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5492
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.