DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Hmx2

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001099773.1 Gene:Hmx2 / 293538 RGDID:1565366 Length:273 Species:Rattus norvegicus


Alignment Length:274 Identity:77/274 - (28%)
Similarity:112/274 - (40%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GPAKSPNSILKPYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLDQ 281
            ||:::|..     ....|.|..|:|:|  ||||.........|                      
  Rat    29 GPSEAPRE-----PAGWPARKRSLSVS--SEEEEPEEGWKAPA---------------------- 64

  Fly   282 PLNLCVV------KKSRDSNNSPMPATKQSQILGKSATKKESSGK-PAAKKKKLSSTVALPPDIS 339
                |..      |:....::.|:|    ...||   |.|.|.|. |||.::        .|.:|
  Rat    65 ----CYCPDPHGPKEPSPKHHPPIP----FPCLG---TPKGSGGAGPAASER--------TPFLS 110

  Fly   340 PTGSSDSLMRDKLMANNSSSPG----SNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTF 400
            |:.......:::|:...|.|||    .:..|:.|:.|                   .|||.||.|
  Rat   111 PSHPDFKEEKERLLPAGSPSPGPERPRDGGAERQAGA-------------------AKKKTRTVF 156

  Fly   401 TGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSS 465
            :..|:::||..|:.|:|||:|||..:|..|.:||||||.||||||.|||:|      .:||.:::
  Rat   157 SRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQ------LSAELEAA 215

  Fly   466 NAKPGATGTATTTP 479
            |....:..|....|
  Rat   216 NMAHASAQTLVGMP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)
Hmx2NP_001099773.1 Homeobox 152..206 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.