DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Hmx3

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001099772.1 Gene:Hmx3 / 293537 RGDID:1559927 Length:356 Species:Rattus norvegicus


Alignment Length:370 Identity:106/370 - (28%)
Similarity:146/370 - (39%) Gaps:99/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PGPPTNWHAHVYDRLPPHPTPHSIADILGMSFVKKERPEVAFDAQGPAKSPNSILK--------- 227
            |||..:..|   ...||.|.|...|                     |.:||.||..         
  Rat     4 PGPDASGTA---SAPPPQPPPQPPA---------------------PKESPFSIRNLLNGDHHRP 44

  Fly   228 PYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLDQPLNLCVVKKSR 292
            |.:.|.|.|:..         ..|:.|.|.:||.||||..|...||..|  |.|..:|...:...
  Rat    45 PPKPQPPPRTLF---------APASAAAAAAAAAAAAAKGALEGAAGFA--LSQVGDLAFPRFEI 98

  Fly   293 DSNNSPMPA--TKQSQILGKSATKKESSG---KPAAKKKKLSSTVALPPDISPTGSSDSLMRDKL 352
            .:....:||  .::|.......|...:.|   :|.|.:|      ||..|.||...:|....|.|
  Rat    99 PAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEK------ALLRDSSPASGTDRDSPDPL 157

  Fly   353 MAN-------NSSSP------------GSNVNAQMQSNANSTLETT-----EDDSDSGSTD---- 389
            :..       :|.||            |......:...|.:|:..|     .:|..:|:..    
  Rat   158 LKADPDHKELDSKSPDEIILEESDSEEGKKEGEAVPGAAGTTVGATAATPGSEDWKAGADSPEKK 222

  Fly   390 -ARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQ-- 451
             |.||||.||.|:..|:|:||..|:.|:|||:|||..:|..|.:|||||||||||||.|||:|  
  Rat   223 PACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLA 287

  Fly   452 -----DNVTNNEAAE--------HKSSNAKPGATGTATTTPSGEP 483
                 .|:::..|..        |::|.|:..|.......|..:|
  Rat   288 AELEAANLSHAAAQRIVRVPILYHENSAAEGAAAAAGAPVPVSQP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 31/51 (61%)
Hmx3NP_001099772.1 Homeobox 230..284 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.