DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and ceh-9

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001021797.1 Gene:ceh-9 / 267057 WormBaseID:WBGene00000434 Length:147 Species:Caenorhabditis elegans


Alignment Length:117 Identity:57/117 - (48%)
Similarity:74/117 - (63%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 LPPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKART 398
            |..|:.|...:..|::|.|     ..|..|..........|:|:..: :|........::|||||
 Worm    17 LTSDVKPQRRTSHLIKDIL-----DLPTVNGEIDEFGRCKSSLDQAK-ESPIEKCQKTKRKKART 75

  Fly   399 TFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKK 450
            ||:|:|:|||||.||.|||||:|:|:|:||.|.|||||||||||||||||||
 Worm    76 TFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 40/51 (78%)
ceh-9NP_001021797.1 Homeobox 74..126 CDD:278475 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167663
Domainoid 1 1.000 99 1.000 Domainoid score I4474
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto20673
orthoMCL 1 0.900 - - OOG6_117800
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17019
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.