DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Nkx2-1

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:XP_006240178.1 Gene:Nkx2-1 / 25628 RGDID:3866 Length:423 Species:Rattus norvegicus


Alignment Length:358 Identity:86/358 - (24%)
Similarity:135/358 - (37%) Gaps:106/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 APRPSSVHPQHQQPQQQTVQLQQQRRSVSTPAITTTPGPPTNWHAHVYDRLPPHPTPHSIADILG 200
            |.:|.|:|.            .|.||:.||| :...|.........:....|.|.||.|::||| 
  Rat    18 ARQPPSLHS------------SQLRRTRSTP-LRVHPTRSALSRRRIMSMSPKHTTPFSVSDIL- 68

  Fly   201 MSFVKKERPEVAFDAQGPAKSPNSILKPYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAA 265
             |.:::...:|..:. |...:|   |..|::.|....::     |.::.:....||.:|      
  Rat    69 -SPLEESYKKVGMEG-GGLGAP---LAAYRQGQAAPPAA-----AMQQHAVGHHGAVTA------ 117

  Fly   266 VAATITAATVATPLDQPLNLCVVKKSRDSNNSPMPATKQSQILGKSATKKESSGKPAAKKKKLSS 330
             |..:|||.|..                              |..||.....:|       .|.:
  Rat   118 -AYHMTAAGVPQ------------------------------LSHSAVGGYCNG-------NLGN 144

  Fly   331 TVALPPDISPTGSSDSLMRDKLMANNSSSPG--------------------SNVNAQMQSNANST 375
            ...|||            ....|.|::|.||                    |.:|........|.
  Rat   145 VSELPP------------YQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSL 197

  Fly   376 LETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIW 440
            .:.:::.:...|..   ::|.|..|:..|::|||:.|:.:|||||.||..:|.::.:|.||||||
  Rat   198 GDVSKNMAPLPSAP---RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIW 259

  Fly   441 FQNRRTKWKKQDNVTNNEAAEHKSSNAKPGATG 473
            |||.|.|.|:|   ..::||:.:......|..|
  Rat   260 FQNHRYKMKRQ---AKDKAAQQQLQQDSGGGGG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)
Nkx2-1XP_006240178.1 Homeobox 215..268 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.