DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Nkx2-9

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:163 Identity:56/163 - (34%)
Similarity:78/163 - (47%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 SNANSTLETTEDDS--------DSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEM 426
            |:..|.|||:..||        :|..:|..:::|.|..|:..|..|||:.|..::||||.||.::
Mouse    50 SSDESGLETSPADSSQLASLRRESPGSDPEKRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQL 114

  Fly   427 AKLLMVTETQVKIWFQNRRTKWK--KQDNVTN-NEAAEHKSSNAKPG------------------ 470
            |:||.:|.|||||||||.|.|.|  :...:|. ::.|.....:|.||                  
Mouse   115 ARLLRLTPTQVKIWFQNHRYKLKRGRAPGITEPSDMAASSDLHAAPGLLRRVVVPVLVHDRPPSN 179

  Fly   471 -ATGTATTTPSGEPTDKRSSN-ATS-PTVGNAA 500
             ..|..|   |..|.||.|:. ||: |..|..|
Mouse   180 NGRGEGT---SAVPQDKCSARLATACPVPGYTA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 28/51 (55%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 9/34 (26%)
Homeobox 84..138 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.