Sequence 1: | NP_001247103.1 | Gene: | NK7.1 / 41747 | FlyBaseID: | FBgn0024321 | Length: | 721 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508815.2 | Gene: | mls-2 / 180751 | WormBaseID: | WBGene00003377 | Length: | 341 | Species: | Caenorhabditis elegans |
Alignment Length: | 263 | Identity: | 78/263 - (29%) |
---|---|---|---|
Similarity: | 113/263 - (42%) | Gaps: | 70/263 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 300 PATKQSQILGKSATKKESSGK-----------PAAKKKKLSSTVALPPDISPTGSSDSLMRDKLM 353
Fly 354 -------------ANNSSSPGSNVNAQ----------------MQSNANSTLET-TEDDSDSG-- 386
Fly 387 ------STD--ARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQN 443
Fly 444 RRTKWKKQDNV--TNNEAAEHKSSNAKPGATGTATTTPSGEPTDKRSSNATSPTVGNAATIAEIK 506
Fly 507 KSP 509 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NK7.1 | NP_001247103.1 | Homeobox | 397..449 | CDD:278475 | 31/51 (61%) |
mls-2 | NP_508815.2 | Homeobox | 204..258 | CDD:395001 | 31/53 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0485 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.770 |