DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and Hmx2

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001355289.1 Gene:Hmx2 / 15372 MGIID:107159 Length:273 Species:Mus musculus


Alignment Length:268 Identity:76/268 - (28%)
Similarity:109/268 - (40%) Gaps:72/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GPAKSPNSILKPYQEQQPIRSSSISMSDASEEESAAVAGATSAATAAAAVAATITAATVATPLDQ 281
            ||:::|..     ....|.|..|:|:|...||....                          ...
Mouse    29 GPSEAPRE-----PAGWPARKRSLSVSSEEEEPEEG--------------------------WKA 62

  Fly   282 PLNLCV----VKKSRDSNNSPMPATKQSQILGKSATKKESSGK-PAAKKKKLSSTVALPPDISPT 341
            |...|.    .|:....:::|:|    ...||   |.|.|.|. |||.::        .|.:||:
Mouse    63 PACFCPDPHGPKEPSPKHHTPIP----FPCLG---TPKGSGGAGPAASER--------TPFLSPS 112

  Fly   342 GSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGRQIF 406
            .......:::|:...|.|||.              |...|......|.| .|||.||.|:..|::
Mouse   113 HPDFKEEKERLLPAGSPSPGP--------------ERPRDGGAERQTGA-AKKKTRTVFSRSQVY 162

  Fly   407 ELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAKPGA 471
            :||..|:.|:|||:|||..:|..|.:||||||.||||||.|||:|      .:||.:::|....:
Mouse   163 QLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQ------LSAELEAANMAHAS 221

  Fly   472 TGTATTTP 479
            ..|....|
Mouse   222 AQTLVGMP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)
Hmx2NP_001355289.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..154 39/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.