DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NK7.1 and NKX2-6

DIOPT Version :9

Sequence 1:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:304 Identity:76/304 - (25%)
Similarity:110/304 - (36%) Gaps:96/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PPHPTPHSIADILGMSFVKKERPEVAFDAQGPAKSPNSILKPYQEQQPIRSSSISMSDA----SE 247
            |...||.|:.|||.:   ::||       ..||.||:    |...:.|.....:.| ||    ||
Human     5 PVTSTPFSVKDILRL---ERER-------SCPAASPH----PRVRKSPENFQYLRM-DAEPRGSE 54

  Fly   248 EESAAVAGATSAATAAAAVAATITAATVATPLDQPLNLCVVKKSRDSNNSPMPATKQSQILGKSA 312
            ..:|...|.                                  .|..:.|..|......:|...|
Human    55 VHNAGGGGG----------------------------------DRKLDGSEPPGGPCEAVLEMDA 85

  Fly   313 TKKESSGKPAAKKKKLSSTVALPPDISPTGSSDSLMRDKLMANNSSSP---GSNVNAQMQSNANS 374
               |..|:|             .|.:                 |::||   |:.|..:...|:..
Human    86 ---ERMGEP-------------QPGL-----------------NAASPLGGGTRVPERGVGNSGD 117

  Fly   375 TLETTEDDSDSGSTDARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKI 439
            ::.    ...|....||:::|.|..|:..|:..||:.|:.::||||.||..:|..|.:|.|||||
Human   118 SVR----GGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKI 178

  Fly   440 WFQNRRTKWKKQDNVTNNEAAEHKSSNAKPGATGTATTTPSGEP 483
            ||||||.|.|:|....:.|.|.|..:   |...........|:|
Human   179 WFQNRRYKCKRQRQDKSLELAGHPLT---PRRVAVPVLVRDGKP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 27/51 (53%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 33/195 (17%)
HOX 132..188 CDD:197696 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.